PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G1357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 347aa    MW: 39789.2 Da    PI: 7.776
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G1357genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.5e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
      Gh_A02G1357 17 KGPWTPEEDRILVDYIQRHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 64
                     79********************************************97 PP

2Myb_DNA-binding56.28.1e-1870115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++eE+  ++++++ lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A02G1357  70 RGRFSEEEEHTIINLHASLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 115
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-241167IPR009057Homeodomain-like
PROSITE profilePS5129418.0361264IPR017930Myb domain
SuperFamilySSF466892.52E-3114111IPR009057Homeodomain-like
SMARTSM007172.6E-151666IPR001005SANT/Myb domain
PfamPF002492.6E-171764IPR001005SANT/Myb domain
CDDcd001674.27E-121964No hitNo description
PROSITE profilePS5129426.84865119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2768119IPR009057Homeodomain-like
SMARTSM007172.3E-1569117IPR001005SANT/Myb domain
PfamPF002491.7E-1670115IPR001005SANT/Myb domain
CDDcd001671.75E-1172115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MMGRPPPCSR DENGLKKGPW TPEEDRILVD YIQRHGHGSW RALPKLAGLN RCGKSCRLRW  60
TNYLRPDIKR GRFSEEEEHT IINLHASLGN KWSAIATHLP GRTDNEIKNF WNTHLRKKLF  120
QMGIDPVTHR PRTDLNILPN LPQLLAAANF TNLMMTNIPL DAAHLAKLQL LHNIIQVLGT  180
TPTMEALNFL AGPTFRANHQ FSNLSLGFAP QELTQLQSNL LNSEAPQQHQ PEVTEYHNQP  240
MEDSNNHQFS SLSPANIPPL LTQSQLPALV PASPERRPQT ENKNINPINI SNPSSTSTTF  300
EGWGDLMDDE ESDSYWRDII RVRINYYLFF KLHLYIQFLH LFMSHFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-28151192105C-Myb DNA-Binding Domain
1msf_C3e-28151192105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472605.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D2NWQ50.0A0A0D2NWQ5_G
STRINGVIT_16s0039g01710.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-92myb domain protein 9